PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000064.1_g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family CAMTA
Protein Properties Length: 1007aa    MW: 113570 Da    PI: 5.9831
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000064.1_g00020.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1177.32e-55201362118
                     CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYah 87 
                              l+ ++rwl++ ei +iL n++k+++t e+  +p sgs++L++rk++ryfrkDG++w+kkkdgktv+E+hekLKvg+v++l+cyYah
  Itr_sc000064.1_g00020.1  20 LEAQHRWLRPAEISEILRNYKKFHITPEPLYKPVSGSVFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDMLHCYYAH 105
                              5679********************************************************************************** PP

                     CG-1  88 seenptfqrrcywlLeeelekivlvhylevk 118
                              +e+n++fqrr+yw+Le +l +iv+vhylevk
  Itr_sc000064.1_g00020.1 106 GEDNENFQRRSYWMLEPDLMHIVFVHYLEVK 136
                              ****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143781.80915141IPR005559CG-1 DNA-binding domain
SMARTSM010763.4E-7918136IPR005559CG-1 DNA-binding domain
PfamPF038593.1E-4921135IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.108.7E-7428516IPR013783Immunoglobulin-like fold
SuperFamilySSF812962.2E-17430516IPR014756Immunoglobulin E-set
PfamPF018332.0E-7430515IPR002909IPT domain
SuperFamilySSF484032.49E-17615719IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.9E-17618749IPR020683Ankyrin repeat-containing domain
PfamPF127961.7E-7618684IPR020683Ankyrin repeat-containing domain
CDDcd002049.12E-16621716No hitNo description
PROSITE profilePS5029719.094624728IPR020683Ankyrin repeat-containing domain
SMARTSM002488.4E-5657686IPR002110Ankyrin repeat
PROSITE profilePS5008811.301657689IPR002110Ankyrin repeat
SMARTSM002481100696725IPR002110Ankyrin repeat
SuperFamilySSF525403.98E-8824879IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.17828850IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.096829858IPR000048IQ motif, EF-hand binding site
PfamPF006120.0016830849IPR000048IQ motif, EF-hand binding site
SMARTSM000156.2E-4851873IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.798852876IPR000048IQ motif, EF-hand binding site
PfamPF006121.1E-4854873IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071275Biological Processcellular response to aluminum ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1007 aa     Download sequence    Send to blast
MAESGSDPLG FRLDIKQILL EAQHRWLRPA EISEILRNYK KFHITPEPLY KPVSGSVFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHEK LKVGSVDMLH CYYAHGEDNE NFQRRSYWML  120
EPDLMHIVFV HYLEVKGNKA MRSIEPTESS SIDESSMSVS SAGNCTKLTS TSADSPSPTS  180
TLTSAYEDVE SEYSHPGTSG LQSFPEIATA GSYSVENVDT VPLQYSAGSQ QTLDLASWEK  240
FLENCTKGDI AYKQDPTNSS SVQTNWQHYS EDPALQFHGQ TVHQGFISDS NYDLGRFSNQ  300
KSLQEYFLNT TGPLDMYPNE TAELPIEMNH QYNPNFDSNV NKVGNEEYSV KKHPLLDGSG  360
VKEGLNKVDS FSRWVDKELE DVEELQMHSS NGISWNVIES EDSDSCIPSQ LQLGSDSLNP  420
SLSQEQLFSI IEFSPMWAYS NKKTKVLITG KFLQTEKEVA KCKWSCMFGE VEVPVEVLPT  480
GLLCCYSPPH RAGTVPFYIT CSNRLACSEV REFEYRAGPS KDTNASDSHT MEVLLHERFE  540
RLLRLGATVS HCSSEDIMEK QTIVNKVIEL MEEQNLCMTD FMDLYEPKNR ELPLFGKELK  600
ERFYTWLLHK INEDGKGPAF VDEEGQGVIH LAAALGYNWA LKPILISGVS IDFRDVNGWT  660
PLHWAAFYGR EETVATLVSL GASPGALTDP SAEFPLGRTP ADLASANGNK GISGFLAESS  720
LTTHLARLDV SDAKENNALD TSKTKEIQTV TERVAVPTTD NVPDVSLNDS LAAVRNATQA  780
AARIHQIFRV QSFQRKKLIE HNGELLSDEQ ALSMVASKTS RLGQKDRIAH AAATQIQKKF  840
RGWKKRKEFL LIRQRVVKIQ AHVRGHQARK KYKPIIWSVG ILEKVILRWR RKGSGLRGFK  900
SDAVAKPIIM EDKPASVEDD YDFLKEGRKQ TEERMQKALS RVKSMAQYPE AREQYRRMLT  960
ATEGVRKTKD ASTAVVGSSE DTSYQDEDLL DIETLLDDDT FMSIAFE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00043PBMTransfer from AT5G64220Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600618.10.0PREDICTED: calmodulin-binding transcription activator 2-like isoform X2
RefseqXP_016485865.10.0PREDICTED: calmodulin-binding transcription activator 2-like isoform X2
SwissprotQ6NPP40.0CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLK4B2930.0K4B293_SOLLC; Uncharacterized protein
STRINGSolyc01g105230.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22302146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.20.0Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains